PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02350.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 355aa    MW: 40997.9 Da    PI: 7.4758
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02350.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.2e-1696141147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg W + Ed +l+++v+ +G+ +W++Ia+++  gR++k+c++rw++ 
  Rsa1.0_02350.1_g00001.1  96 RGHWRPAEDVKLKELVAIYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 141
                              899*****************************.***********996 PP

2Myb_DNA-binding591.1e-18148191146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ 
  Rsa1.0_02350.1_g00001.1 148 RRAFTEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHV 191
                              678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.82291142IPR017930Myb domain
SMARTSM007174.8E-1495144IPR001005SANT/Myb domain
PfamPF002492.2E-1596141IPR001005SANT/Myb domain
SuperFamilySSF466892.36E-2896189IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2597149IPR009057Homeodomain-like
CDDcd001673.99E-1299140No hitNo description
PROSITE profilePS5129427.753143197IPR017930Myb domain
SMARTSM007174.1E-15147195IPR001005SANT/Myb domain
PfamPF002491.5E-15148190IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-21150196IPR009057Homeodomain-like
CDDcd001671.93E-11150190No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MYMSGKQRWM DENEIAAVRR EVSSWDFPFN DINIQLHGRC NTGHEFDILK SPFGVNEEES  60
NNHNRNYSNS ESAKKETTDS GQSWSSSSSK QSVLGRGHWR PAEDVKLKEL VAIYGPQNWN  120
LIAEKLEGRS GKSCRLRWFN QLDPRINRRA FTEEEEERLM QAHRLYGNKW AMIARLFPGR  180
TDNSVKNHWH VIMARKYREH SSAYRRRKLV INNPLKPLLP NHPNPSPIYN SFISTKHYLT  240
QPYHEFNLTH QLVNNASVTT DHNQLVLPFH CFQGCERTEA SMVVSMFSNQ MMVGGDNVGA  300
TSEALHNFPY VDSMSQEKGV PNEAMNLIGM EVVDEEVAEK ARQQPYFFDF LGLGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-32941965107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3348160.0AF334816.1 Arabidopsis thaliana putative transcription factor (MYB117) mRNA, complete cds.
GenBankAY5195590.0AY519559.1 Arabidopsis thaliana MYB transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ4462910.0DQ446291.1 Arabidopsis thaliana clone pENTR221-At1g26780 myb family transcription factor (At1g26780) mRNA, complete cds.
GenBankDQ6528620.0DQ652862.1 Arabidopsis thaliana clone 0000017266_0000012084 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013738679.10.0PREDICTED: transcription factor MYB24-like
TrEMBLA0A078ILC50.0A0A078ILC5_BRANA; BnaC05g51000D protein
STRINGBra016285.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.21e-173myb domain protein 117